Home Store Opening Soon The Standard COA Library Research Hub Contact Partner Program

LL-37 Cathelicidin Antimicrobial Peptide: A 2026 Research Guide

Among the host-defense peptides that show up in a research library, LL-37 occupies an unusual position: it is not a synthetic construct or an engineered analog but the only cathelicidin the human body actually makes, studied for decades as a model of how a single small peptide can be antimicrobial, immunomodulatory, and angiogenic all at once. That breadth is exactly why it is interesting as an in-vitro reference material — and it is also why LL-37 landed in the middle of the 2026 regulatory reshuffling of research peptides, removed from the FDA’s Category 2 “do not compound” list in April 2026 and slated for a later Pharmacy Compounding Advisory Committee review. This guide surveys what LL-37 is at the molecular level, what its mechanisms actually are at the pathway and receptor level, what the published preclinical literature supports, and how to evaluate a source of research-grade material.

The information below is provided for in-vitro and preclinical laboratory research context only. Nothing here describes human use, dosing, or therapeutic outcomes.

Section 1 — Molecular Profile

LL-37 is a 37-residue cationic, amphipathic peptide and the sole antimicrobial peptide of the human cathelicidin family. It is catalogued under CAS number 597562-32-8, with the amino-acid sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES and an average molecular weight of approximately 4493.3 g/mol (molecular formula on the order of C205H340N60O53). The name derives from the first two residues of the mature sequence — a pair of leucines — followed by its 37-amino-acid length.

The peptide does not exist in isolation in biology. It is the C-terminal effector fragment of a larger precursor, the 18-kDa human cationic antimicrobial protein hCAP18, which is stored in an inactive pro-peptide form in the secondary granules of neutrophils and produced by epithelial cells. Extracellular proteinase 3 cleaves hCAP18 to liberate the active 37-residue LL-37. Structurally, the mature peptide folds into an amphipathic α-helix in the presence of anionic membranes or physiological salt, segregating its cationic and hydrophobic residues onto opposite faces of the helix — the architecture that underlies almost everything it does. A high net positive charge (from its many lysine and arginine residues) drives its selective attraction to negatively charged microbial surfaces, and its length of 37 residues keeps it comfortably inside the sub-40-amino-acid window that defines a peptide under the current regulatory framework.

Section 2 — Mechanism at the Pathway and Receptor Level

LL-37 is best understood as two mechanistic stories sharing one molecule: a direct membrane-active story and a receptor-mediated signaling story.

The membrane-active mechanism is electrostatic and physical. As a cationic amphipathic helix, LL-37 is attracted to the anionic phospholipids and surface molecules of microbial membranes. It first associates with the outer membrane as monomers and oligomers, then accumulates parallel to the bilayer surface in what the literature describes as a “carpet” arrangement. Above a threshold surface density, this carpet destabilizes the bilayer and induces leakage, in some models through transient toroidal pores. In parallel, LL-37 binds and neutralizes lipopolysaccharide (LPS) from gram-negative bacteria and lipoteichoic acid (LTA) from gram-positive bacteria through direct electrostatic interaction between the cationic peptide and these anionic microbial components — an LPS-sequestering activity studied extensively in cell-free and cell-based endotoxin models.

The receptor-mediated mechanism is where LL-37’s immunomodulatory and angiogenic activities live. Much of this signaling is attributed to formyl peptide receptor 2 (FPR2, also called FPRL1), a G-protein-coupled receptor on endothelial cells, monocytes, and other cell types. Through FPR2 and related pattern-recognition and cell-surface receptors, LL-37 has been studied for chemotactic and pro-angiogenic effects in vitro. A separate, well-characterized angiogenic route runs through prostaglandin signaling: work in endothelial cells has mapped an LL-37-induced angiogenic response mediated by PGE2 acting on the EP3 receptor. In keratinocyte models, LL-37 exposure has been associated in vitro with activation of MAPK and PI3K-Akt signaling cascades and downstream transcriptional and matrix-remodeling programs. The unifying theme is that LL-37’s “beyond-antimicrobial” activities are receptor-dependent signaling events, not the same physical membrane disruption that kills microbes.

Section 3 — Preclinical and In-Vitro Research Data

The in-vitro record on LL-37 is broad because the peptide touches several fields at once. In antimicrobial assays, LL-37 shows activity against a range of gram-negative and gram-positive bacteria and has been studied against fungal and enveloped-viral targets in cell-free and cell-culture systems, with potency modulated strongly by ionic strength, serum, and pH — a sensitivity that makes reproducible buffer conditions essential in any experiment.

In endothelial-cell models, recombinant LL-37 has been reported to induce proliferation, migration, and the formation of tube-like structures, with associated upregulation of angiogenic mediators such as VEGF-A and IL-6 in some systems, and vessel formation in the chick chorioallantoic membrane (CAM) assay used as a standard angiogenesis readout. In keratinocyte (HaCaT) models relevant to epithelial-repair research, LL-37 delivery has been associated with enhanced re-epithelialization markers in vitro. Because the native peptide is sensitive to proteolysis and to inactivation by physiological salt, a large fraction of the preclinical literature actually studies LL-37 delivered from nanoparticle or nanomicelle carriers, or studies engineered fragments and analogs designed to retain activity while reducing the hemolytic and cytotoxic effects the full-length peptide can show at higher concentrations. That cytotoxicity-versus-selectivity tension is itself an active in-vitro research question and a reason many groups work with modified derivatives.

Section 4 — Published Literature

The literature below is drawn from real published, peer-reviewed sources and is cited here strictly as research context.

A 2025 review in Pharmacological Research on the role of cathelicidin LL-37 and ceragenins in wound-healing processes surveys the in-vitro and preclinical mechanisms attributed to the peptide. A 2025 review, “Decoding LL-37: structure and antimicrobial mechanisms against microbial threats,” lays out the current model of membrane interaction and the carpet/toroidal-pore mechanisms. A 2025 update, “Human antimicrobial/host defense peptide LL-37 may prevent the spread of a local infection through multiple mechanisms” (PMC11893641), consolidates the multi-mechanism view of the peptide. On the angiogenesis side, “Cathelicidin LL-37 Induces Angiogenesis via PGE2–EP3 Signaling in Endothelial Cells” (Arteriosclerosis, Thrombosis, and Vascular Biology, 2013) established the prostaglandin-mediated route. The foundational demonstration that LL-37/hCAP-18 is a direct angiogenic peptide acting on endothelial cells was reported by Koczulla and colleagues in the Journal of Clinical Investigation (2003). “Wound healing activity of the human antimicrobial peptide LL37” (Peptides, 2011) documented the in-vitro epithelial-repair-associated activity. Molecular-dynamics work modeling LL-37 in POPC and POPG lipid bilayers (PMC5979298) provides the biophysical basis for its membrane selectivity, and a 2023 study on the design and characterization of non-hemolytic antimicrobial peptides related to LL-37 (PMC10204126) illustrates the active effort to separate antimicrobial potency from cytotoxicity.

The consistent lesson across this body of work is that LL-37’s behavior is exquisitely condition-dependent — sequence, charge, membrane composition, salt, and delivery format all move the result — which places a premium on precisely characterized, correctly identified material.

Section 5 — Research Applications

In an in-vitro setting, LL-37 is used primarily as a reference antimicrobial and host-defense peptide. Common research applications include membrane-interaction and pore-formation studies in model lipid bilayers and liposomes; LPS- and LTA-neutralization assays in cell-free and macrophage systems; antimicrobial susceptibility screening under controlled ionic conditions; endothelial-cell angiogenesis assays (proliferation, migration, tube formation, CAM); keratinocyte and fibroblast scratch-migration models of epithelial repair; and as a comparator peptide in the development and benchmarking of engineered antimicrobial-peptide analogs. It also serves as a demanding analytical and formulation test case, precisely because its activity is so sensitive to buffer, carrier, and proteolytic environment. All of these are laboratory research contexts only.

Section 6 — How to Evaluate a Source

LL-37 is a comparatively long, highly charged peptide, which makes both its synthesis and its characterization non-trivial — and that raises the stakes on documentation. A defensible source of research-grade LL-37 provides a lot-specific Certificate of Analysis that names the exact batch rather than reusing a generic product-line spec. It reports HPLC purity with a visible chromatogram, not merely a typed percentage, so peak shape and integration can be judged. It confirms identity by mass spectrometry — critical for a 37-mer where deletion sequences and incomplete couplings are plausible synthesis byproducts and where a bare purity number cannot establish that the correct sequence is even present. It reports a full safety panel — endotoxin and heavy metals — for material headed into cell-based work, which matters especially for a peptide whose own activity is defined against endotoxin. And it names an accredited, independent laboratory, ideally ISO/IEC 17025 accredited, with results verifiable at that laboratory’s own domain rather than as a vendor-hosted image. As a market-context note, properly characterized peptide of this length is not cheap to make or test; a rock-bottom price attached to no verifiable analytical file is a statement about documentation, not a bargain.

Section 7 — The PYXAX Verification Standard

PYXAX uses accredited independent laboratories in its verification network, including ILS Labs, Krause Analytical, and Janoshik. The current per-batch panel covers purity by HPLC, potency against label claim, and identity by LC-MS. A lot-specific COA is published in the COA Library before dispatch and names the laboratory that tested that batch. Endotoxin, heavy-metals, and final-vial sterility screening are not part of the current panel.

For a peptide like LL-37 — long enough for synthesis byproducts to matter, charged enough to be analytically demanding, and biologically defined against the very endotoxin that a safety panel measures — that orthogonal, lab-named verification is the only meaningful quality signal. Explore the current verification documents in the COA library at /coa-library/, review the PYXAX analytical standard at /standard/, and see available research compounds at /shop/. Lot-specific analytical data is linked from each listing at /product/ll-37-cathelicidin-antimicrobial-peptide-research-2026/.

All PYXAX compounds are supplied strictly for in-vitro and preclinical laboratory research use only. Not for human consumption. Not for veterinary use. Not for diagnostic procedures. These statements have not been evaluated by the FDA. Researchers are responsible for compliance with all applicable laws and regulations governing the use of research compounds in their jurisdiction.

Catalog context

Compounds discussed in this reference

Product pages provide current strengths, availability, and lot-specific verification status.

FOR LABORATORY RESEARCH USE ONLY · NOT FOR HUMAN CONSUMPTION · FOR QUALIFIED RESEARCHERS ONLY

Research updates

Stay ahead of what's next.

Get notified about new research compounds, newly published verification records, restocks, and PYXAX platform updates.

No noise. Unsubscribe anytime. Privacy Policy