Home Store Opening Soon The Standard COA Library Research Hub Contact Partner Program

FOXO4-DRI: Retro-Inverso Design, the FOXO4–p53 Interface, and the Senolytic Preclinical Record — A 2026 Research Guide

Most research peptides are copies of something the body already makes. FOXO4-DRI is not. It is a designed molecule — a fragment of a human transcription factor, rebuilt backwards out of mirror-image amino acids, and fused to a cationic delivery module borrowed from a virus. It was introduced in a 2017 Cell paper as a proof of concept for a then-novel idea: that senescent cells stay alive by actively suppressing their own apoptotic machinery, and that interrupting one specific protein–protein interaction could remove them selectively. Nine years and several independent replications later, FOXO4-DRI remains the reference compound of the peptide senolytics field, and one of the more analytically demanding molecules a laboratory will handle. This guide summarizes the molecular profile, the pathway-level mechanism, and the published preclinical record as it stands in 2026.

The information below describes in-vitro and preclinical laboratory research only. It is not medical guidance, and none of the findings described here establish safety or efficacy in humans.

Section 1 — Molecular Profile

FOXO4-DRI is a synthetic 46-residue peptide composed entirely of D-amino acids arranged in reverse sequence order relative to the parent L-peptide — the “D-retro-inverso” (DRI) construction that gives the compound its name. It has no endogenous counterpart. The molecule is assembled from two functional halves: an N-terminal segment derived from the FOXO4 Forkhead domain region that contacts p53, and a C-terminal polycationic cell-penetrating module derived from the HIV-1 TAT transduction sequence.

Key identifiers used in the literature and on analytical documentation:

  • Compound name: FOXO4-DRI; FOXO4 D-retro-inverso peptide; occasionally listed under the trade-style name Proxofim
  • CAS number: 2460055-10-9
  • Molecular formula: C228H388N86O64
  • Molecular weight: approximately 5,358.1 Da (average)
  • Length: 46 amino acid residues, single linear chain, all-D configuration
  • Sequence (one-letter, as written): LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG — all residues in the D-configuration
  • Class: protein–protein interaction inhibitor; FOXO4–p53 binding antagonist; cell-penetrating peptide
  • Composition note: 10 arginine and 4 lysine residues; net charge strongly positive at physiological pH

The composition is the first thing worth internalizing. Fourteen of forty-six residues are basic. Nothing about handling this peptide resembles handling a short neutral sequence. Adsorptive loss to glass and untreated polypropylene at low working concentrations is severe, and the counterion burden on lyophilized material is correspondingly high — trifluoroacetate from reversed-phase purification associates with every basic side chain, which is why gross vial weight and net peptide content can diverge substantially on a molecule of this charge density. A vial specified by gross weight is not the same experimental input as one specified by net peptide content, and on a 46-mer with ten arginines the gap is not trivial.

The retro-inverso construction is the second. In a DRI peptide, reversing the sequence and inverting the chirality of every residue produces a molecule whose side-chain topology approximates the original L-peptide while its backbone runs in the opposite direction. The practical purpose is protease resistance: proteolytic enzymes are stereospecific, and an all-D chain is essentially invisible to them. The design cost is that backbone hydrogen-bonding geometry is not preserved, so retro-inverso mimicry is reliable for interactions dominated by side-chain contacts and unreliable for those requiring a specific backbone fold. Whether FOXO4-DRI’s binding is faithfully retro-inverso or something more idiosyncratic was an open question in the literature until structural work published in 2025 addressed it directly (Section 2).

The all-D composition also creates an analytical problem specific to this compound, discussed in Section 6: D- and L-amino acids are isobaric. Mass spectrometry cannot distinguish them. A perfect LC-MS identity result on FOXO4-DRI does not confirm that the material is the D-peptide at all.

Section 2 — Mechanism

All activity described here is at the protein-interaction and pathway level, in defined experimental systems.

The target interaction. In cells that have entered senescence, the forkhead transcription factor FOXO4 is upregulated and localizes to PML nuclear bodies, where it binds p53. That binding sequesters p53 in the nucleus. Because nuclear-retained p53 does not engage the mitochondrial apoptotic program, the senescent cell persists in a viable but arrested state rather than dying. This is the FOXO4–p53 axis: a survival dependency that senescent cells acquire and non-senescent cells do not have.

Competitive displacement. FOXO4-DRI comprises the p53-interacting region of FOXO4. Introduced into the cell by its cationic transduction module, it competes with endogenous FOXO4 for the same site on p53. Displacement releases p53 from nuclear sequestration; the released, phosphorylated protein is excluded from the nucleus and directed to the mitochondria, where it engages the intrinsic apoptotic pathway — BAX/BCL-2 rebalancing and caspase-3 activation are the endpoints most often reported. Because non-senescent cells do not accumulate FOXO4 in PML bodies and do not depend on FOXO4–p53 sequestration for survival, the disruption has been reported as selective for the senescent population in the systems tested.

Structural basis. A 2025 Nature Communications paper resolved the interaction by solution NMR and found it to be considerably more interesting than a simple lock-and-key displacement. The target on p53 is transactivation subdomain 2 (TAD2), an intrinsically disordered region. FOXO4-DRI is itself disordered in solution. The two form what the authors describe as a transiently folded complex — a coupled folding-and-binding event rather than a rigid interface — and both halves of the peptide contribute: the FOXO4-derived region and the cationic cell-permeability segment each participate in binding. The same work reported that phosphorylation of p53 increases affinity for both native FOXO4 and FOXO4-DRI, which supplies a mechanistic reason why the interaction is amplified under the stress-signaling conditions that characterize senescence.

Downstream pathway readouts. In the cell systems studied, the consequences reported downstream of the displacement include p53 nuclear exclusion, activation of the mitochondrial apoptotic cascade in senescent cells, and reductions in senescence-associated markers — SA-β-galactosidase activity, p16INK4a, p21, and components of the senescence-associated secretory phenotype (SASP) including IL-1β, IL-6, and TGF-β. Reductions in reactive oxygen species have also been reported in endothelial senescence models. FOXO4 sits within broader insulin/PI3K–AKT, cell-cycle, and oxidative-stress signaling networks, and interpretation of any FOXO4-directed perturbation has to account for that context.

Throughout the literature these are mechanisms FOXO4-DRI has been studied for and researched for — FOXO4–p53 interface antagonism, p53 nuclear exclusion, senescent-cell-selective apoptosis in culture, and SASP marker reduction in preclinical models — not demonstrated clinical effects in humans.

Section 3 — Preclinical and In-Vitro Research Data

The originating work is Baar and colleagues, Cell, 2017. Working in IMR90 human fibroblasts and in mouse models, the group reported that a cell-penetrating peptide perturbing the FOXO4–p53 interaction caused p53 nuclear exclusion and cell-intrinsic apoptosis in senescent cells while sparing non-senescent controls. The paper reported effects in a doxorubicin chemotoxicity model, in a fast-ageing Xpg-/- mouse model, and in naturally aged mice, with restoration of several tissue-homeostasis parameters. It is the paper that established senolysis-by-protein-interaction-inhibition as a viable design strategy, and it is the citation every subsequent study anchors to.

Replication has come from independent groups working in unrelated cell types, which is the more informative signal.

In reproductive biology, Liu and colleagues reported in Aging in 2020 that FOXO4 is expressed in human Leydig cells with nuclear translocation observed in aged testes, and that FOXO4-DRI induced apoptosis in senescent Leydig cells in aged mice, reduced SASP factor secretion, and improved proliferation of co-cultured germ cells. A 2024 follow-on in Mechanisms of Ageing and Development extended the same model, reporting improved spermatogenesis in aged mice attributed to reduced SASP output from the Leydig population.

In tissue engineering, Huang and colleagues published in Frontiers in Bioengineering and Biotechnology in 2021 on a specific practical problem: expanding human chondrocytes in vitro for autologous chondrocyte implantation generates senescent cells that degrade the quality of the resulting cartilage. The group reported that FOXO4-DRI removed senescent cells generated by several different induction methods from expanded chondrocyte populations. This is one of the clearer demonstrations of the compound functioning as a laboratory tool rather than a therapeutic candidate — the target was a cell culture, not an organism.

More recent work has extended into fibroblast and vascular biology. A 2025 Communications Biology paper reported that FOXO4-DRI induced apoptosis in keloid-derived senescent fibroblasts, with the mechanism attributed to nuclear exclusion of p53 phosphorylated at serine 15. A 2025 paper in Frontiers in Bioengineering and Biotechnology reported that FOXO4-DRI modulated endothelial cell senescence through p53 signaling, with the BAX/BCL-2/caspase-3 axis, SASP markers, and ROS levels as the measured readouts.

Two limitations of the record should be stated plainly. First, essentially all of it is cell culture and rodent work; there is no human outcome evidence for this compound, and the peptide-senolytics field as a whole has not produced controlled human data comparable to what exists for small-molecule senolytic candidates. Second, FOXO4 expression is not uniform across human tissues — protein-atlas data indicate a restricted distribution — and several authors have flagged that selectivity arguments derived from fibroblast models do not automatically generalize. The compound’s own literature is more careful about this than most secondary summaries of it.

Section 4 — Published Literature

The following are real, published papers anchoring the FOXO4-DRI record. Researchers should consult the primary sources rather than relying on summaries.

  • Baar MP, Brandt RMC, Putavet DA, et al. (2017). “Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging.” Cell 169(1):132–147.e16. PMID 28340339. The originating study.
  • Liu G, Li T, Yang X, et al. (2020). “FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice.” Aging (Albany NY) 12(2):1272–1284. PMC7053614.
  • Huang Y, He Y, Makarcyzk MJ, Lin H (2021). “Senolytic Peptide FOXO4-DRI Selectively Removes Senescent Cells From in vitro Expanded Human Chondrocytes.” Frontiers in Bioengineering and Biotechnology 9:677576. PMC8116695.
  • Le HH, Cinaroglu SS, Manalo EC, et al. (2021). “Molecular modelling of the FOXO4-TP53 interaction to design senolytic peptides for the elimination of senescent cancer cells.” EBioMedicine 73:103646. PMID 34689087. PMC8546421.
  • FOXO4-DRI improves spermatogenesis in aged mice through reducing senescence-associated secretory phenotype secretion from Leydig cells (2024). Mechanisms of Ageing and Development.
  • The disordered p53 transactivation domain is the target of FOXO4 and the senolytic compound FOXO4-DRI (2025). Nature Communications 16:5672. PMID 40593617. The NMR characterization of the binding mode.
  • Structural plasticity of the FOXO-DBD:p53-TAD interaction (2025). Nature Communications 16, DOI 10.1038/s41467-025-59106-5.
  • FOXO4-DRI induces keloid senescent fibroblast apoptosis by promoting nuclear exclusion of upregulated p53-serine 15 phosphorylation (2025). Communications Biology 8, DOI 10.1038/s42003-025-07738-0.
  • Hu Z, et al. (2025). “FOXO4-DRI regulates endothelial cell senescence via the P53 signaling pathway.” Frontiers in Bioengineering and Biotechnology 13:1729166.

Together these span the originating proof of concept, independent replication in three unrelated primary cell types, the computational redesign effort, and the structural biology that finally explained how the peptide actually binds.

Section 5 — Research Applications

In laboratory settings, FOXO4-DRI appears principally as a senolytic reference compound and as a probe of the FOXO4–p53 interface. Reported in-vitro applications include use as the positive-control senolytic in senescent-versus-proliferating cell viability panels; as a tool for depleting senescent cells from expanded primary cell cultures prior to downstream assays; as a probe in p53 subcellular-localization studies by immunofluorescence and fractionation; as a comparator in screens for improved FOXO4–p53 interaction inhibitors, including the computationally redesigned variants described in the 2021 EBioMedicine work; and as a stimulus in SASP-profiling experiments measuring cytokine transcription and secretion in senescent cultures.

Several handling variables materially affect reproducibility on a molecule with this charge density. Adsorptive loss is the leading source of apparent potency drift, and low-binding labware with a carrier protein in the working buffer is the standard countermeasure at low concentrations. Lyophilized material is generally stored at −20°C or below, desiccated and protected from light, with reconstituted stock aliquoted immediately to avoid freeze-thaw cycling. Solubility behaviour reflects the cationic character: the peptide is water-soluble but sensitive to buffer ionic strength, and precipitation on dilution into high-salt media is a recognized nuisance.

Senescence assays are also unusually sensitive to the choice of induction method and passage number. The 2021 chondrocyte work is instructive here — it tested multiple senescence-induction routes precisely because a senolytic that clears one type of senescent cell may not clear another. Any comparison of FOXO4-DRI results across papers has to account for how senescence was generated in the first place.

Section 6 — How to Evaluate a Source

FOXO4-DRI is the case where a standard certificate of analysis is genuinely insufficient, and understanding why separates informed sourcing from guesswork.

The compound is an all-D peptide. D- and L-amino acids have identical masses. LC-MS identity confirmation cannot distinguish FOXO4-DRI from its all-L sequence isomer — an L-peptide of the same composition would return the same mass and could return a very similar HPLC retention time. Confirming chirality requires an orthogonal method: chiral amino acid analysis after hydrolysis, Marfey’s-reagent derivatization, or at minimum a comparative circular dichroism spectrum against a reference. This is not a hypothetical concern. D-amino acid building blocks cost substantially more than their L counterparts, and the analytical panel most vendors publish would not detect a substitution.

Beyond that, on a 46-mer the routine checks matter more than usual:

  • Purity by HPLC, with a stated percentage and a visible chromatogram. Deletion sequences — chains missing one or more residues from incomplete coupling — are the dominant impurity class in long solid-phase syntheses, and they co-elute closely with the target. A bare number without a trace is not evidence.
  • Identity by LC-MS, with an observed mass consistent with roughly 5,358 Da, and with the deconvoluted spectrum shown so that −113 Da (leucine/isoleucine deletion) and similar satellite peaks are visible.
  • Chiral confirmation, per the above. Ask for it explicitly; treat its absence as unresolved rather than as a failure.
  • Endotoxin by USP <85> LAL, with an actual figure. Note a technical wrinkle specific to polycationic peptides: they bind lipopolysaccharide and can interfere with LAL assays, so the method used and any inhibition/enhancement control should be stated.
  • Heavy metals by ICP-MS.
  • Net peptide content, disclosed. On a peptide carrying fourteen basic residues, counterion and residual water mass are a large fraction of gross weight.
  • Lot-specificity: the COA must correspond to the exact batch shipped, be dated, and name the accredited laboratory that performed the testing.

Market pricing context: catalog chemical suppliers list research-grade FOXO4-DRI at roughly $150–$185 per milligram at the 1 mg scale, with per-milligram cost falling to approximately $50–$75 at the 10 mg scale. That floor is set by real synthesis economics — a 46-residue chain built entirely from D-amino acid building blocks is among the more expensive routine peptide syntheses. A listing far below the prevailing range for this length and composition is worth investigating in the analytical data before it is worth celebrating. Price is a poor proxy for quality in either direction; the COA, and specifically the chirality question, is where the difference becomes visible.

Section 7 — The PYXAX Verification Standard

PYXAX uses accredited independent laboratories in its verification network, including ILS Labs, Krause Analytical, and Janoshik. The current per-batch panel covers purity by HPLC, potency against label claim, and identity by LC-MS. A lot-specific COA is published in the COA Library before dispatch and names the laboratory that tested that batch. Endotoxin, heavy-metals, and final-vial sterility screening are not part of the current panel.

Founding batches are documented end to end, and full analytical data files are available per lot. You can review current documentation in the COA library, read the underlying methodology on the verification standard page, see the FOXO4-DRI listing, or browse the full catalog in the shop.

All PYXAX compounds are supplied strictly for in-vitro and preclinical laboratory research use only. Not for human consumption. Not for veterinary use. Not for diagnostic procedures. These statements have not been evaluated by the FDA. Researchers are responsible for compliance with all applicable laws and regulations governing the use of research compounds in their jurisdiction.

Catalog context

Compounds discussed in this reference

Product pages provide current strengths, availability, and lot-specific verification status.

FOR LABORATORY RESEARCH USE ONLY · NOT FOR HUMAN CONSUMPTION · FOR QUALIFIED RESEARCHERS ONLY

Research updates

Stay ahead of what's next.

Get notified about new research compounds, newly published verification records, restocks, and PYXAX platform updates.

No noise. Unsubscribe anytime. Privacy Policy