Teduglutide ([Gly2]GLP-2): DPP-4-Resistant Analog Design, GLP-2R/IGF-1 Paracrine Signaling, and the Single-Residue Identity Problem — A 2026 Research Guide

Almost every proglucagon-derived compound in the research market points at the same organ. Semaglutide, tirzepatide, retatrutide, survodutide, mazdutide — different scaffolds, different receptor combinations, all studied through the lens of systemic metabolism. Teduglutide is the outlier. It comes from the same precursor protein and the same class B GPCR family, but has nothing to do with the incretin axis. Its receptor is expressed almost nowhere except the gut, and the cells expressing it are not the cells that respond. That indirect architecture makes teduglutide an instructive object for anyone thinking about how paracrine signaling is demonstrated rather than assumed — and the molecule differs from its native parent by a single methyl group, which creates an analytical problem worth spelling out.

The information below describes in-vitro and preclinical laboratory research only. It is not medical guidance, and none of the findings described here establish safety or efficacy in humans.

Section 1 — Molecular Profile

Teduglutide is a synthetic analog of human glucagon-like peptide-2, distinguished from the native sequence by one conservative substitution at the second residue.

• Compound names: teduglutide; [Gly2]GLP-2; ALX-0600; h[Gly2]GLP-2
• CAS number: 197922-42-2
• Molecular formula: C164H252N44O55S
• Molecular weight: approximately 3,752.1 Da (free base); gross vial weight will exceed net peptide content in salt presentations
• Structure class: 33-residue linear unmodified peptide, free C-terminus, no lipidation, no PEGylation, no non-proteinogenic residues
• Sequence (one-letter): HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
• Sequence (three-letter): His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp

Three structural features carry the pharmacology and, downstream, the analytics.

The Ala2→Gly2 substitution. Native human GLP-2 begins His-Ala-Asp. Teduglutide begins His-Gly-Asp. Alanine and glycine differ by a single methyl group — 14 daltons across a 3,752-dalton molecule, roughly 0.37 percent. That one methyl group is the entire design premise, because position 2 is the residue dipeptidyl peptidase-4 recognises. This is the same protease-evasion strategy later formalised as the Aib2 substitution in semaglutide and tirzepatide; teduglutide is the earlier, more conservative version.

No modification chemistry. Unlike essentially every other proglucagon-family compound in the research market, teduglutide carries no fatty acid, no albumin-binding domain, and no PEG linker. Its half-life extension comes entirely from protease resistance rather than carrier-protein binding — which also removes the large hydrophobic handle that makes lipidated peptides easy to separate on reversed-phase, a point Section 6 returns to.

A single methionine. Met10 is the only sulphur-containing residue and the principal oxidation liability. Methionine sulphoxide formation adds 16 daltons and is a routine degradant in improperly stored peptide, which matters both for stability specification and for what an identity spectrum should be scrutinised for. Standard storage is sealed and desiccated at −20 °C or below, protected from light and moisture.

Regulatory context, unusual for a compound in this category: teduglutide is an approved drug product. The European Commission authorised it in August 2012 and the FDA in December 2012, with orphan designation for short bowel syndrome. That is a regulatory fact about the drug product, not a statement about research-grade lyophilized material, which is supplied under a different posture for a different purpose entirely.

Section 2 — Mechanism

All activity described here is at the receptor and pathway level, in defined experimental systems.

Where the receptor is, and where it is not. The GLP-2 receptor was cloned and characterised by Munroe and colleagues in 1999 as a class B secretin-family GPCR — the same structural family as GLP-1R and GCGR. Its expression pattern is the mechanistically decisive fact. Yusta and colleagues (2000, Gastroenterology) localised GLP-2R expression in humans and rodents to a restricted set of gastrointestinal cell populations, and subsequent work established that within the intestinal wall the receptor sits predominantly on subepithelial myofibroblasts and enteroendocrine cells of the lamina propria — not on the crypt epithelial cells that show the proliferative response. Rowland and Brubaker’s 2011 review in American Journal of Physiology — Gastrointestinal and Liver Physiology framed this precisely as the “cryptic” mechanism of action problem.

The paracrine relay. The resolution is an indirect two-cell model. GLP-2R engagement on subepithelial myofibroblasts activates Gs-coupled adenylyl cyclase, raises intracellular cAMP, and drives protein kinase A signaling; the myofibroblast then secretes paracrine growth factors — IGF-1 principally, with keratinocyte growth factor and ErbB-family ligands including EGF also implicated — which act on receptors expressed by the adjacent crypt epithelium. IGF-1 engages IGF-1R on crypt cells, with downstream phosphatidylinositol-3-kinase/Akt and β-catenin signaling as the characterised proliferative arms. Dubé and colleagues (2006, Gastroenterology) established the IGF-1 dependence genetically rather than by inference; a 2011 Gastroenterology report showed that deletion of the intestinal epithelial IGF-1 receptor abolishes the GLP-2-induced proliferative response in mice, and a 2020 Endocrinology paper extended the analysis to the interaction between GLP-2, EGF, and epithelial IGF-1R in crypt cell proliferation.

Barrier and stem-cell readouts. Benjamin and colleagues (2000, Gut) reported GLP-2 altering both transcellular and paracellular permeability in mouse tissue, with functional changes at four hours preceding morphological changes at forty-eight — the separation of kinetics being the useful finding, because it distinguishes a signaling effect from a growth effect. More recent work in Cellular and Molecular Gastroenterology and Hepatology reported GLP-2 stimulating S-phase entry of Lgr5+ intestinal stem cells, placing the response in a defined stem-cell compartment.

What the Gly2 substitution does. Drucker and colleagues (1997, Nature Biotechnology) provided the direct demonstration: native GLP-2(1-33) was degraded to the truncated GLP-2(3-33) fragment on incubation with human placental DPP-IV or rat serum, but not with serum from DPP-IV-deficient rats, while the synthetic [Gly2]GLP-2 analog resisted that cleavage. That paper is the origin of the compound and a clean methodological template — enzyme source, deficient-animal control, and fragment identification are all specified.

Throughout, these are pathways teduglutide has been studied for — GLP-2R binding and Gs/cAMP/PKA activation, myofibroblast IGF-1 secretion, epithelial IGF-1R and β-catenin signaling, and barrier-permeability readouts in preclinical models — not demonstrated clinical effects, and nothing here should be read as a claim about outcomes in humans.

Section 3 — Preclinical and In-Vitro Research Data

The founding observation. Drucker, Erlich, Asa and Brubaker (1996, PNAS) reported that nude mice bearing subcutaneous proglucagon-producing tumors showed marked proliferation of the small intestinal epithelium, and identified GLP-2 as the factor responsible — establishing the peptide as the most potent intestinotrophic product of the proglucagon precursor in the mouse. Every subsequent paper in the field points back to it.

Receptor pharmacology and growth-factor dependence. The 1999 PNAS cloning paper characterised the receptor in transfected heterologous systems, and companion work by Yusta and colleagues identified GLP-2R-activated signaling pathways in baby hamster kidney fibroblasts stably expressing the rat receptor. The IGF-1 arm is the most thoroughly interrogated part of the mechanism: the 2006 Dubé paper, the 2011 epithelial IGF-1R deletion study, and the 2020 Endocrinology analysis form a coherent genetic series in mice, each removing a component and observing the loss of the proliferative response. A 2019 report in Scientific Reports (9:12213) extended the framework to microvillus length.

Model systems and their limits. Rodent work dominates — mice and rats in models of intestinal resection, chemotherapy-induced mucosal injury, and inflammatory bowel models — with neonatal piglet models appearing in the nutritional literature. Three limitations deserve statement. Because the response is paracrine, in-vitro results depend on whether the culture system contains GLP-2R-expressing cells at all; much confusion in the older literature traces to assays run in epithelial lines that do not express the receptor, and co-culture or conditioned-medium designs are the honest way to model the relay. GLP-2R expression is also not identically distributed across rodents, pigs and humans, so quantitative extrapolation is not warranted. And a large human clinical literature exists from the approval programme; no efficacy figures are reproduced here, no therapeutic conclusion is drawn, and none of that record transfers to research-grade lyophilized material.

Section 4 — Published Literature

Real, published papers anchoring the teduglutide and GLP-2 record. Researchers should consult primary sources directly.

• Drucker DJ, Erlich P, Asa SL, Brubaker PL (1996). “Induction of intestinal epithelial proliferation by glucagon-like peptide 2.” PNAS 93(15):7911–7916. PMID 8755576. DOI 10.1073/pnas.93.15.7911.
• Drucker DJ, Shi Q, Crivici A, et al. (1997). “Regulation of the biological activity of glucagon-like peptide 2 in vivo by dipeptidyl peptidase IV.” Nature Biotechnology 15(7):673–677. DOI 10.1038/nbt0797-673.
• Munroe DG, Gupta AK, Kooshesh F, et al. (1999). “Prototypic G protein-coupled receptor for the intestinotrophic factor glucagon-like peptide 2.” PNAS 96(4):1569–1573.
• Benjamin MA, McKay DM, Yang PC, Cameron H, Perdue MH (2000). “Glucagon-like peptide-2 enhances intestinal epithelial barrier function of both transcellular and paracellular pathways in the mouse.” Gut 47(1):112–119. PMID 10861272.
• Yusta B, Huang L, Munroe D, et al. (2000). “Enteroendocrine localization of GLP-2 receptor expression in humans and rodents.” Gastroenterology 119(3):744–755.
• Dubé PE, Forse CL, Bahrami J, Brubaker PL (2006). “The essential role of insulin-like growth factor-1 in the intestinal tropic effects of glucagon-like peptide-2 in mice.” Gastroenterology 131(2):589–605.
• Rowland KJ, Brubaker PL (2011). “The ‘cryptic’ mechanism of action of glucagon-like peptide-2.” Am J Physiol Gastrointest Liver Physiol 301(1):G1–G8. DOI 10.1152/ajpgi.00039.2011.
• Rowland KJ, et al. (2011). “Loss of glucagon-like peptide-2-induced proliferation following intestinal epithelial insulin-like growth factor-1-receptor deletion.” Gastroenterology 141(6):2166–2175.
• Drucker DJ, Yusta B (2014). “Physiology and pharmacology of the enteroendocrine hormone glucagon-like peptide-2.” Annual Review of Physiology 76:561–583.
• (2019). “The roles of glucagon-like peptide-2 and the intestinal epithelial insulin-like growth factor-1 receptor in regulating microvillus length.” Scientific Reports 9:12213. DOI 10.1038/s41598-019-49510-5.
• (2020). “GLP-2, EGF, and the intestinal epithelial IGF-1 receptor interactions in the regulation of crypt cell proliferation.” Endocrinology 161(4):bqaa040. PMID 32147716.

Section 5 — Research Applications

In laboratory settings this compound appears principally in gastrointestinal epithelial biology and in comparative proglucagon-family receptor pharmacology. Reported in-vitro applications include competitive binding and cAMP accumulation assays against GLP-2R in transfected BHK, HEK293 or CHO backgrounds; DPP-4 stability comparisons against native GLP-2(1-33) with fragment identification by LC-MS; myofibroblast cultures measuring IGF-1 induction following receptor engagement; epithelial–myofibroblast co-culture and conditioned-medium designs modelling the paracrine relay; transepithelial electrical resistance and tracer-flux barrier assays; organoid and enteroid systems, with and without a stromal compartment, for crypt and Lgr5+ stem-cell work; and β-catenin, Akt and ErbB phosphorylation assays as downstream readouts.

Design variables worth attention. Because the response is indirect, the most consequential decision is whether the system contains GLP-2R-expressing cells at all — a negative result in a pure epithelial monolayer is a statement about the model. Because Met10 oxidises, stock handling and freeze–thaw history affect what is actually in the well. And because the compound’s defining property is protease resistance, any stability comparison needs the DPP-4 source, activity units and buffer specified, with native peptide as the positive control.

Section 6 — How to Evaluate a Source

Teduglutide sits in an awkward analytical position. It is a comparatively simple molecule — no lipidation, no linker, no exotic residues — which makes it easier to synthesise well and, correspondingly, easier to synthesise as something almost-but-not-quite right. The failure modes differ from those of the lipidated incretin analogs, and are less forgiving of casual documentation.

Fourteen daltons is the whole compound. Native human GLP-2 and teduglutide differ by one methyl group: roughly 3,766 Da versus 3,752 Da. On a 33-mer analysed by low-resolution deconvoluted mass with a few daltons of accuracy, that difference is not comfortably resolved — and native GLP-2 is cheaper and more widely available. The question is answerable: high-resolution LC-MS with reported charge states, or MS/MS fragmentation confirming the N-terminus reads His-Gly-Asp rather than His-Ala-Asp. A single deconvoluted mass on a routine instrument does not settle it.

Oxidation is a reportable species, not a rounding error. Met10 sulphoxide adds 16 daltons — close enough to the 14-dalton analog difference to create genuine ambiguity on a poorly resolved spectrum, and a real impurity class in its own right. A COA reporting total purity without addressing oxidised species on a methionine-containing peptide has left out the most likely degradant.

Reversed-phase separation is harder without a lipid handle. On lipidated peptides the fatty acid dominates retention and pulls the main peak clear of backbone-related impurities. Teduglutide has no such handle: deletion sequences, D-amino acid epimers, and the Ala2 native form all elute close to the parent on a steep gradient. A shallow, well-developed gradient with a stated column, mobile phase and run time is the difference between a chromatogram that resolves those species and a picture of one peak.

What the analytical package needs to show:

• Purity by HPLC, with a stated percentage and the trace. Relevant impurity classes for an unmodified 33-mer are deletion and truncation sequences, methionine sulphoxide, deamidation at the several Asn/Gln positions, epimers, and aggregate. A bare “≥99%” identifies none of them.
• Identity by LC-MS, observed mass reported against approximately 3,752.1 Da for the free base, with enough method detail — ideally fragmentation evidence across the N-terminal region — to establish that the Gly2 form was confirmed rather than assumed.
• Endotoxin by USP <85> LAL, with an actual figure rather than a “meets specification” checkbox.
• Heavy metals by ICP-MS.
• Net peptide content and counterion, disclosed. Acetate and trifluoroacetate carry different mass burdens, and residual TFA is biologically active in some cell assays at concentrations that survive lyophilization — a real confound in cAMP and proliferation work.
• Lot-specificity. The COA must correspond to the exact batch shipped, be dated, and name the accredited laboratory that performed the testing. A COA reused across lots is a marketing document.

Market and regulatory context. Research-grade material in this class is listed across a wide band at the 5–10 mg scale, and the spread carries almost no information about analytical quality. What separates lots is whether anyone measured the thing that distinguishes this molecule from its parent. On regulatory posture, teduglutide is an approved drug product in the United States and European Union rather than an investigational agent, which places it in a different frame from the novel incretin analogs. It was not among the seven peptides reviewed at the July 2026 PCAC meeting, and it is not among the five scheduled for the review due before the end of February 2027.

Section 7 — The PYXAX Verification Standard

PYXAX uses accredited independent laboratories in its verification network, including ILS Labs, Krause Analytical, and Janoshik. The current per-batch panel covers purity by HPLC, potency against label claim, and identity by LC-MS. A lot-specific COA is published in the COA Library before dispatch and names the laboratory that tested that batch. Endotoxin, heavy-metals, and final-vial sterility screening are not part of the current panel.

On a compound whose entire identity rests on one methyl group at position two, the identity determination is not a formality appended to a purity number. It is the measurement that establishes whether the vial contains the protease-resistant analog described in the literature or the native peptide it was designed to replace. A published mass spectrum and chromatogram on the actual lot settles in one document what no amount of label copy can.

Founding batches are documented end to end, with full analytical data files available per lot. You can review current documentation in the COA library, read the underlying methodology on the verification standard page, or browse the full catalog in the shop.

All PYXAX compounds are supplied strictly for in-vitro and preclinical laboratory research use only. Not for human consumption. Not for veterinary use. Not for diagnostic procedures. These statements have not been evaluated by the FDA. Researchers are responsible for compliance with all applicable laws and regulations governing the use of research compounds in their jurisdiction.